"initiatorBinding" : true, }, "action" : "rerender" LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1979172}},{"elementId":"link_10","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1979178}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1979181}}]); })(LITHIUM.jQuery); } "event" : "deleteMessage", "actions" : [ "parameters" : { ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "initiatorBinding" : true, Ich kann das Guthaben meiner B.free Wertkarte nicht aufladen – was kann ich tun? LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/Archiv_CallYa/thread-id/61825","ajaxErrorEventName":"LITHIUM:ajaxError","token":"bqH7HHQ_mUPSBdSyU4F_WLzQJ0LbIGkSb2svVloY6pY. return; Unter der Option "Karte aufladen" erhalten Sie die Möglichkeit, Ihre CallYa-Karte per PayPal aufzuladen. "context" : "", }, "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "action" : "rerender" watching = false; Sobald die Zahlung erfolgreich abgeschlossen wurde, wird der Vodafone Guthabencode direkt angezeigt und per E-Mail zugeschickt. "event" : "deleteMessage", }); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "initiatorDataMatcher" : "data-lia-message-uid" "event" : "unapproveMessage", "kudosLinksDisabled" : "false", "actions" : [ /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "initiatorDataMatcher" : "data-lia-kudos-id" { ] Das klingt erstmal gut, doch der Teufel steckt im Detail. $('#vodafone-community-header .lia-search-input-wrapper').fadeToggle() $('#node-menu li.active').children('ul').show(); LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_0","menuItemsSelector":".lia-menu-dropdown-items"}}); "useCountToKudo" : "false", if ( count == neededkeys.length ) { "action" : "rerender" ] "useSubjectIcons" : "true", "action" : "rerender" var ctaHTML = '. ] }); }); "context" : "envParam:quiltName", "useSimpleView" : "false", LITHIUM.AjaxSupport.ComponentEvents.set({ { Achtung: Es kann vorkommen, dass die Emails im Spam-Ordner landen. "event" : "MessagesWidgetEditAnswerForm", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "RevokeSolutionAction", "initiatorDataMatcher" : "data-lia-message-uid" "eventActions" : [ "selector" : "#kudosButtonV2_0", Bist du sicher, dass du fortfahren möchtest? Hat Dir die Antwort geholfen? ] } "actions" : [ Nun das … { } }; "actions" : [ ] var clickHandler = function(event) { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "truncateBody" : "true", "event" : "removeMessageUserEmailSubscription", "actions" : [ ] "actions" : [ ], "context" : "", } "initiatorDataMatcher" : "data-lia-kudos-id" }); { "action" : "rerender" { }, ] "activecastFullscreen" : false, Was Sie benötigen: PayPal-Konto; CallYa-Karte von Vodafone. "disableKudosForAnonUser" : "false", Ich kann mein Steam guthaben nicht aufladen Ich versuche schon seit gestern mein steam guthaben aufzuladen, es geht aber bei keiner zahlungsmöglichkeit und ich habe eig schon alles gemacht.. pc neu gestartet, support angeschrieben u.s.w was meint ihr was ich noch machen kann ? { { }, "context" : "", { ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "showCountOnly" : "false", window.location = "https://forum.vodafone.de/t5/Archiv-CallYa/Ich-kann-kein-Guthaben-aufladen/td-p/1979172" + "/page/" + 1; "disableLinks" : "false", "closeEvent" : "LITHIUM:lightboxCloseEvent", { { "actions" : [ }); "eventActions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", "action" : "rerender" } "truncateBodyRetainsHtml" : "false", element.siblings('li').children('ul').slideUp(); "context" : "", "actions" : [ hallo, habt ihr erfahrungen mit dem anbieter lyca mobile? "action" : "rerender" LITHIUM.Auth.CHECK_SESSION_TOKEN = 'YwSMvtfspEHJQ9Mw2bIJ9cbwJG_2TwuR7Q_hHK8IHy8. LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; "actions" : [ { "useTruncatedSubject" : "true", } { "initiatorDataMatcher" : "data-lia-message-uid" ] Per Tastenkombination: *100*(Aufladecode)# eintippen und anschließend die Wahltaste drücken. ] "actions" : [ ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); var clickHandler = function(event) { { "context" : "envParam:entity", }, }, "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", LITHIUM.StarRating('#any_2', false, 1, 'LITHIUM:starRating'); "truncateBody" : "true", { "actions" : [ { ] { } "quiltName" : "ForumMessage", "actions" : [ } LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_65b50b2c3106e4', 'disableAutoComplete', '#ajaxfeedback_65b50b2b75783d_0', 'LITHIUM:ajaxError', {}, 'gvTmYJx4YqtsUo2S07m25sgYYzsW-zqkMze46w5qG_A. "action" : "rerender" ] "eventActions" : [ ] LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); "componentId" : "forums.widget.message-view", "quiltName" : "ForumMessage", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/61825","ajaxErrorEventName":"LITHIUM:ajaxError","token":"g7NAHIq29hTcqFIab5z4sGRYzUwigWkEyqhJyYONcyE. "event" : "markAsSpamWithoutRedirect", { }, ] } }, count = 0; } } else { "action" : "pulsate" "context" : "", LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; Nun rubbeln Sie das Feld frei, in dem die Aufladenummer steht. ] Die persönliche Aufladenummer wird auch Cash-Code genannt. '; "action" : "rerender" //$('#vodafone-community-header, #vodafone-community-header .lia-search-input-wrapper').css('display','none'); LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1979172}},{"elementId":"link_10","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1979178}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1979181}}]); { }, "dialogContentCssClass" : "lia-panel-dialog-content", // just for convenience, you need a login anyways... ] } }); }, "parameters" : { LITHIUM.AjaxSupport.ComponentEvents.set({ Du hast die App noch nicht? "event" : "kudoEntity", { Ich mach das schon ewig so. LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_65b50b2beccfa1', 'disableAutoComplete', '#ajaxfeedback_65b50b2b75783d_0', 'LITHIUM:ajaxError', {}, 'XF_tt33bg9ZIWSRrY3Ir6zAHDQ1LL7bTCIdF4M74Kfs. { { // Oops, not the right sequence, lets restart from the top. "actions" : [ "kudosable" : "true", "context" : "", var keycodes = { } Mit dem so aufge­lade­nen Guthaben kannst Du gle­ich im Play Store einkaufen. ] { "action" : "rerender" LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1979181 .lia-rating-control-passive', '#form_1'); warum muß ich meine prepaid-karte aufladen trotz guthaben? "displaySubject" : "true", } "message" : "1979178", "actions" : [ expireDate.setDate(expireDate.getDate() + 365*10); "messageViewOptions" : "1111110111111111111110111110100101001101" "context" : "", { $(event.data.selector).removeClass('cssmenu-open'); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_12","feedbackSelector":".InfoMessage"}); }, "event" : "QuickReply", window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":358,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXBFcKAFRWDlABBRgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVQV1AMUAYDXxQGW1VSSQFWVwZIDgMKAU8EUlAMA1FRUVRXDAFAThUPVn1bVgB\/AhsIQCNFB11aQm0mVwpVawNAG0ZeUGZXFkIwC2MXB0UdFwkWYSB6I3pmQgtTRHNhe39FWwNKQQMFUhcVZHx3N3NGTV0SC1RKXFcJDUV6L3R7NkIIRkhO"}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { return; } var resetMenu = function() { LITHIUM.AjaxSupport.fromLink('#kudoEntity', 'kudoEntity', '#ajaxfeedback', 'LITHIUM:ajaxError', {}, '7H1Lu1nvg_ofx4cW0yyqSep67tUg4YfpbefeXy5AUhw. Datenerfassung Job Teilzeit, 988 Bgb Rechtsfolgenverweisung, Hanna Binke Mutter, Mannheimer Morgen Digital Login, Wie Schreibt Man Es Schneit, Us-aktien Kaufen Steuern, Siemens Support E-mail, " />

ich kann mein guthaben nicht aufladen vodafone

December 29th, 2020 by

], } } "action" : "rerender" { Du lädst einfach dein persönliches Kundenkonto mit Guthaben auf und löst es anschließend für deine persönlichen Zwecke ein. "action" : "rerender" // Reset the conditions so that someone can do it all again. { }, "context" : "envParam:quiltName", "selector" : "#kudosButtonV2_1", "showCountOnly" : "false", "actions" : [ { "event" : "removeMessageUserEmailSubscription", Ich kann auch nicht aufladen. // We're good so far. }, } "event" : "kudoEntity", Ihr könnt euch vorstellen, wie ärgerlich das ist, wenn man sehr viel Prepaid-Guthaben aufgeladen hat und auf einmal beispielsweise 50 Euro weg sind. "Wie lade ich mein Vodafone-Guthaben auf?" watching = false; { }, LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; })(LITHIUM.jQuery); LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); Ihre Vodafone Guthaben können Sie im Handumdrehen mit dem Code, den Sie von Guthaben.de erhalten haben, aufladen. "parameters" : { LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); }, { "context" : "envParam:quiltName,message", } "}); "action" : "rerender" Google-Play-Guthaben kauf­st Du online auf Web­seit­en oder offline in Geschäften. "event" : "addThreadUserEmailSubscription", Per Anruf: Rufe die Vodafone Service Hotline unter 22 9 22 an und befolge den Sprachanweisungen. }; { "forceSearchRequestParameterForBlurbBuilder" : "false", } $(this).next().toggle(); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/Archiv_CallYa/thread-id/61825","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Bm-jHNUSpzhoEP8uG5tvyUZ-cF3r0Z09iNxJEbT21bE. "displayStyle" : "horizontal", "action" : "rerender" "actions" : [ { "event" : "RevokeSolutionAction", count = 0; { ] ] } "action" : "rerender" "actions" : [ // --> "initiatorBinding" : true, }, "action" : "rerender" LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1979172}},{"elementId":"link_10","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1979178}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1979181}}]); })(LITHIUM.jQuery); } "event" : "deleteMessage", "actions" : [ "parameters" : { ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "initiatorBinding" : true, Ich kann das Guthaben meiner B.free Wertkarte nicht aufladen – was kann ich tun? LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/Archiv_CallYa/thread-id/61825","ajaxErrorEventName":"LITHIUM:ajaxError","token":"bqH7HHQ_mUPSBdSyU4F_WLzQJ0LbIGkSb2svVloY6pY. return; Unter der Option "Karte aufladen" erhalten Sie die Möglichkeit, Ihre CallYa-Karte per PayPal aufzuladen. "context" : "", }, "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "action" : "rerender" watching = false; Sobald die Zahlung erfolgreich abgeschlossen wurde, wird der Vodafone Guthabencode direkt angezeigt und per E-Mail zugeschickt. "event" : "deleteMessage", }); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "initiatorDataMatcher" : "data-lia-message-uid" "event" : "unapproveMessage", "kudosLinksDisabled" : "false", "actions" : [ /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "initiatorDataMatcher" : "data-lia-kudos-id" { ] Das klingt erstmal gut, doch der Teufel steckt im Detail. $('#vodafone-community-header .lia-search-input-wrapper').fadeToggle() $('#node-menu li.active').children('ul').show(); LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_0","menuItemsSelector":".lia-menu-dropdown-items"}}); "useCountToKudo" : "false", if ( count == neededkeys.length ) { "action" : "rerender" ] "useSubjectIcons" : "true", "action" : "rerender" var ctaHTML = '. ] }); }); "context" : "envParam:quiltName", "useSimpleView" : "false", LITHIUM.AjaxSupport.ComponentEvents.set({ { Achtung: Es kann vorkommen, dass die Emails im Spam-Ordner landen. "event" : "MessagesWidgetEditAnswerForm", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "RevokeSolutionAction", "initiatorDataMatcher" : "data-lia-message-uid" "eventActions" : [ "selector" : "#kudosButtonV2_0", Bist du sicher, dass du fortfahren möchtest? Hat Dir die Antwort geholfen? ] } "actions" : [ Nun das … { } }; "actions" : [ ] var clickHandler = function(event) { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "truncateBody" : "true", "event" : "removeMessageUserEmailSubscription", "actions" : [ ] "actions" : [ ], "context" : "", } "initiatorDataMatcher" : "data-lia-kudos-id" }); { "action" : "rerender" { }, ] "activecastFullscreen" : false, Was Sie benötigen: PayPal-Konto; CallYa-Karte von Vodafone. "disableKudosForAnonUser" : "false", Ich kann mein Steam guthaben nicht aufladen Ich versuche schon seit gestern mein steam guthaben aufzuladen, es geht aber bei keiner zahlungsmöglichkeit und ich habe eig schon alles gemacht.. pc neu gestartet, support angeschrieben u.s.w was meint ihr was ich noch machen kann ? { { }, "context" : "", { ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "showCountOnly" : "false", window.location = "https://forum.vodafone.de/t5/Archiv-CallYa/Ich-kann-kein-Guthaben-aufladen/td-p/1979172" + "/page/" + 1; "disableLinks" : "false", "closeEvent" : "LITHIUM:lightboxCloseEvent", { { "actions" : [ }); "eventActions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", "action" : "rerender" } "truncateBodyRetainsHtml" : "false", element.siblings('li').children('ul').slideUp(); "context" : "", "actions" : [ hallo, habt ihr erfahrungen mit dem anbieter lyca mobile? "action" : "rerender" LITHIUM.Auth.CHECK_SESSION_TOKEN = 'YwSMvtfspEHJQ9Mw2bIJ9cbwJG_2TwuR7Q_hHK8IHy8. LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; "actions" : [ { "useTruncatedSubject" : "true", } { "initiatorDataMatcher" : "data-lia-message-uid" ] Per Tastenkombination: *100*(Aufladecode)# eintippen und anschließend die Wahltaste drücken. ] "actions" : [ ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); var clickHandler = function(event) { { "context" : "envParam:entity", }, }, "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", LITHIUM.StarRating('#any_2', false, 1, 'LITHIUM:starRating'); "truncateBody" : "true", { "actions" : [ { ] { } "quiltName" : "ForumMessage", "actions" : [ } LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_65b50b2c3106e4', 'disableAutoComplete', '#ajaxfeedback_65b50b2b75783d_0', 'LITHIUM:ajaxError', {}, 'gvTmYJx4YqtsUo2S07m25sgYYzsW-zqkMze46w5qG_A. "action" : "rerender" ] "eventActions" : [ ] LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); "componentId" : "forums.widget.message-view", "quiltName" : "ForumMessage", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/61825","ajaxErrorEventName":"LITHIUM:ajaxError","token":"g7NAHIq29hTcqFIab5z4sGRYzUwigWkEyqhJyYONcyE. "event" : "markAsSpamWithoutRedirect", { }, ] } }, count = 0; } } else { "action" : "pulsate" "context" : "", LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; Nun rubbeln Sie das Feld frei, in dem die Aufladenummer steht. ] Die persönliche Aufladenummer wird auch Cash-Code genannt. '; "action" : "rerender" //$('#vodafone-community-header, #vodafone-community-header .lia-search-input-wrapper').css('display','none'); LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1979172}},{"elementId":"link_10","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1979178}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1979181}}]); { }, "dialogContentCssClass" : "lia-panel-dialog-content", // just for convenience, you need a login anyways... ] } }); }, "parameters" : { LITHIUM.AjaxSupport.ComponentEvents.set({ Du hast die App noch nicht? "event" : "kudoEntity", { Ich mach das schon ewig so. LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_65b50b2beccfa1', 'disableAutoComplete', '#ajaxfeedback_65b50b2b75783d_0', 'LITHIUM:ajaxError', {}, 'XF_tt33bg9ZIWSRrY3Ir6zAHDQ1LL7bTCIdF4M74Kfs. { { // Oops, not the right sequence, lets restart from the top. "actions" : [ "kudosable" : "true", "context" : "", var keycodes = { } Mit dem so aufge­lade­nen Guthaben kannst Du gle­ich im Play Store einkaufen. ] { "action" : "rerender" LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1979181 .lia-rating-control-passive', '#form_1'); warum muß ich meine prepaid-karte aufladen trotz guthaben? "displaySubject" : "true", } "message" : "1979178", "actions" : [ expireDate.setDate(expireDate.getDate() + 365*10); "messageViewOptions" : "1111110111111111111110111110100101001101" "context" : "", { $(event.data.selector).removeClass('cssmenu-open'); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_12","feedbackSelector":".InfoMessage"}); }, "event" : "QuickReply", window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":358,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXBFcKAFRWDlABBRgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVQV1AMUAYDXxQGW1VSSQFWVwZIDgMKAU8EUlAMA1FRUVRXDAFAThUPVn1bVgB\/AhsIQCNFB11aQm0mVwpVawNAG0ZeUGZXFkIwC2MXB0UdFwkWYSB6I3pmQgtTRHNhe39FWwNKQQMFUhcVZHx3N3NGTV0SC1RKXFcJDUV6L3R7NkIIRkhO"}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { return; } var resetMenu = function() { LITHIUM.AjaxSupport.fromLink('#kudoEntity', 'kudoEntity', '#ajaxfeedback', 'LITHIUM:ajaxError', {}, '7H1Lu1nvg_ofx4cW0yyqSep67tUg4YfpbefeXy5AUhw.

Datenerfassung Job Teilzeit, 988 Bgb Rechtsfolgenverweisung, Hanna Binke Mutter, Mannheimer Morgen Digital Login, Wie Schreibt Man Es Schneit, Us-aktien Kaufen Steuern, Siemens Support E-mail,